Fragments of CR1 and their use
Number of patents in Portfolio can not be more than 2000
United States of America Patent
Stats
-
Sep 28, 2004
Grant Date -
Oct 3, 2002
app pub date -
Dec 1, 1998
filing date -
Mar 2, 1996
priority date (Note) -
Expired
status (Latency Note)
Importance
Abstract
A polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, of 6-23 amino acids in length and comprising sequence a) and/or b): a) GGRKVF, b) FELVGEPSIY multimeric and chimeric derivatives, pharmaceutiocal compositions containing them and their use in therapy.
First Claim
Family
International Classification(s)
- [Classification Symbol]
- [Patents Count]
Cited Art Landscape
Patent Citation Ranking
Recipient Email Address
Recipient Email Address
Comment
Recipient Email Address
Add to Portfolio(s)
To add this patent to one, or more, of your portfolios, simply click the add button.
This Patent is in these Portfolios:
Add to additional portfolios:
Last Refreshed On:
Changes done successfully