Immunologically active proteins from Borrelia burgdorferi, nucleic acids which encode them, and their use in test kits and as vaccines
Number of patents in Portfolio can not be more than 2000
United States of America Patent
Stats
-
Aug 26, 2003
Issued Date -
N/A
app pub date -
Feb 12, 1999
filing date -
Aug 14, 1996
priority date (Note) -
In Force
status (Latency Note)
Importance
Abstract
The present invention relates to immunologically active proteins from Borrelia burgdorferi which are present in a form which is free of other proteins derived from Borrelia burgdorferi and which exhibit the sequence of the protein 1829-22A, which has the amino acid sequence MKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAEDKGVNFAAFTSSETG SKVTNGGLALREAKIQAINEVEKFLKRIEEEALKLKEHGNSGQFLELFDLLLEVLESLEPIGIKG LKDFISEEAKCNPISTSERLIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK SEQ. ID NO.: 1 or a part sequence thereof having at least 10 consecutive amino acids, or exhibit the sequence of the protein 1829-22B, which has the amino acid sequence MIKYNKIILTLTLLASLLAACSLTGKARLESSVKDITNEIEKAIKEAEDAGVKTDAFTETQTGGK VAGPKIRAAKIRVADLTIKFLEATEEETITFKENGAGEDEFSGIYDLILNAAKAVEKIGMKDMTK TVEEAAKENPKTTANGIIEIVKVMKAKVENIKEKQTKNQK SEQ. ID NO.: 2 or a part sequence thereof having at least 10 consecutive amino acids.
First Claim
Family
International Classification(s)
Cited Art Landscape
Patent Citation Ranking
Recipient Email Address
Recipient Email Address
Comment
Recipient Email Address
Add to Portfolio(s)
To add this patent to one, or more, of your portfolios, simply click the add button.
This Patent is in these Portfolios:
Add to additional portfolios:
Last Refreshed On:
Changes done successfully