Treatment agent for cognitive impairment induced by amyloid beta-protein, therapeutic agent for alzheimer's disease, and treatment method and pathological analysis method related to these
Number of patents in Portfolio can not be more than 2000
United States of America Patent
Stats
-
Feb 19, 2019
Grant Date -
Feb 8, 2018
app pub date -
Oct 5, 2017
filing date -
Apr 19, 2013
priority date (Note) -
In Force
status (Latency Note)
Importance
Abstract
Disclosed is a method of treatment for anti-Alzheimer's disease based on an action mechanism associated with amyloid β protein, which action mechanism is different from conventional action mechanisms. The treatment Alzheimer's disease uses a therapeutic agent for cognitive impairment induced by amyloid β protein, which therapeutic agent comprises a peptide having the amino acid sequence represented by SEQ ID NO:1 or a peptide similar to this peptide, especially a peptide containing the amino acid sequence represented by SEQ ID NO:2, which is a partial sequence of SEQ ID NO:1. VLSSQQFLHRGHQPPPEMAGHSLASSHRNSMIPSAAT (SEQ ID NO:1) HRGHQPPPEMA (SEQ ID NO:2).
First Claim
Family
International Classification(s)
- [Classification Symbol]
- [Patents Count]
Cited Art Landscape
Patent Citation Ranking
Recipient Email Address
Recipient Email Address
Comment
Recipient Email Address
Add to Portfolio(s)
To add this patent to one, or more, of your portfolios, simply click the add button.
This Patent is in these Portfolios:
Add to additional portfolios:
Last Refreshed On:
Changes done successfully