Cyclic peptide from novel bone morphogenetic protein 2, preparation method therefor and application thereof
Number of patents in Portfolio can not be more than 2000
United States of America
Stats
-
Jan 7, 2025
Grant Date -
Dec 2, 2021
app pub date -
Apr 15, 2021
filing date -
Apr 15, 2021
priority date (Note) -
In Force
status (Latency Note)
Importance
Abstract
A cyclic peptide from a bone morphogenetic protein 2 (BrvIP2). The cyclic peptide from the novel BMP2 is selected from one of the following cyclic polypeptides: 1. a cyclic polypeptide having the sequence of CKIPKASSVPTELSAISMLYLGPGGDWIVAC (SEQ ID NO:1); and 2. a cyclic polypeptide of which the sequence has an 80% homology with the sequence defined in item 1. A preparation method for the cyclic peptide from the novel Blv1P2, and an application thereof in the preparation of the composite material for promoting the repair of large-sized bone defects.
First Claim
Family
International Classification(s)
- [Classification Symbol]
- [Patents Count]
Cited Art Landscape
Patent Citation Ranking
Recipient Email Address
Recipient Email Address
Comment
Recipient Email Address
Add to Portfolio(s)
To add this patent to one, or more, of your portfolios, simply click the add button.
This Patent is in these Portfolios:
Add to additional portfolios:
Last Refreshed On:
Changes done successfully